DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and agfg1a

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_021337018.1 Gene:agfg1a ZFINID:ZDB-GENE-030131-5808 Length:596 Species:Danio rerio

Alignment Length:309 Identity:62/310 (20%)
Similarity:105/310 (34%) Gaps:102/310 (33%)


  Fly    24 QTRRHIKRWVSPTLRELAHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESFELSELQ---- 84
            |..:|:|     .|||:.    .|.|    .|..| :.:||...:| ...:| ||..:...    
Zfish     9 QEEKHLK-----MLREMT----SLAP----NRKCF-DCDQRGPTYA-NMTVG-SFVCTSCSGILR 57

  Fly    85 --------RAFTEKSFAEREEDRRRQLGIE-----------ESDLQMPHNSDLVEKGQQIARAYV 130
                    ::.:..:|.::|.:..::.|.|           :.:|.:|   |..|..:      |
Zfish    58 GLNPPHRVKSISMTTFTQQEIELLQKHGNEVCKQIWLGLYDDRNLAIP---DFREPQK------V 113

  Fly   131 EAFLQHQLPK----VPNEGLQAIASYLLSTETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLHAV 191
            :.|||.:..|    ||.|..:.:||        .|.|       :..|:....|:..:.:.|..:
Zfish   114 KEFLQDKYEKKRWYVPPEQAKTVAS--------VHAS-------ISGSSASSTSSTPEVRPLKTL 163

  Fly   192 IGALASSSGIERAFIFVRDFICTQLNQKDLLEVWTP-QEPI----QLLEKICQERKLGEAEPRLL 251
            :|....|               ..||:.      || |.|:    ||..:..|:||..     ||
Zfish   164 LGESVPS---------------LHLNKN------TPSQSPVVSRAQLAHQQYQDRKFD-----LL 202

  Fly   252 GDCGKNTVLAAYQVGI----YANRQLLGKGFGEDVKTATETAALDALQS 296
            .|.|.:.....:....    :||.........:.|..:.:.|..|..:|
Zfish   203 SDLGGDIFAPPHSQSTGNANFANFAHFNSHSAQSVNASADFANFDTFKS 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 48/260 (18%)
RIBOc 81..219 CDD:197778 27/165 (16%)
agfg1aXP_021337018.1 ArfGap 17..134 CDD:214518 29/137 (21%)
DNA_pol3_gamma3 <365..594 CDD:331207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.