DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and Mrpl44

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001026820.1 Gene:Mrpl44 RGDID:1309556 Length:332 Species:Rattus norvegicus

Alignment Length:322 Identity:110/323 (34%)
Similarity:172/323 (53%) Gaps:28/323 (9%)


  Fly    15 KLLEGSPTVQTRRHIKRWVSPTL-----------RELAHRQKKL-------GPQKPERRSGFVEW 61
            :||:..|     |.:....:|||           |.....||:|       .|..|.|||....|
  Rat     7 RLLQQGP-----RRLLAPAAPTLVPPVRGVKKGFRAAFRFQKELERWRLLRSPPPPVRRSEKPNW 66

  Fly    62 NQRSELFAFGKRLGESFELSELQRAFTEKSFAEREEDRRRQLGIEESD--LQMPHNSDLVEKGQQ 124
            :..:|:.|||.||.|:|.|..|:.||....:.:.||.:|:.||||:..  |.:..|.:|.|:|..
  Rat    67 DYHAEIQAFGSRLQEAFSLDLLKTAFVNSCYIKSEEAKRQNLGIEKEAALLNLKDNQELFEQGLS 131

  Fly   125 IARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLH 189
            .:...:..||:.:.|.:|.||::::.::|.....:.||:::|..:.|..|.|:|.......::..
  Rat   132 FSHRCLTQFLEDEFPNLPTEGIESLVNFLTGEAVVCHVASNLAVEQLTLSAEFPVPQPVLRRTFF 196

  Fly   190 AVIGALASSSGIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERKLGEAEPRLLGDC 254
            ||||||..|||.|||.:|:|||:.||:..|:|.|:||...|:.||.:..::|.:...|.||....
  Rat   197 AVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTIVNPMGLLVEELKKRNISAPESRLTRQS 261

  Fly   255 GKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQSIFDTRDNRRPFDFAIQLEPK 316
            |..|.|..|.||:|.:::|:.:|.||.|..|.|.||..||:.::...:||||:|::   :||
  Rat   262 GSTTALPLYFVGLYCDKRLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWDYS---KPK 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 82/226 (36%)
RIBOc 81..219 CDD:197778 47/140 (34%)
Mrpl44NP_001026820.1 DSRM 236..304 CDD:294045 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C154584151
eggNOG 1 0.900 E1_COG0571
Hieranoid 1 1.000
Homologene 1 1.000 H11293
Inparanoid 1 1.050 186 1.000 Inparanoid score I3787
OMA 1 1.010
OrthoDB 1 1.010 D533666at33208
OrthoFinder 1 1.000 FOG0005163
OrthoInspector 1 1.000 T1088168
orthoMCL 1 0.900 OOG5_133939
Panther 1 1.100 LDO PTHR11207
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.