DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and pac1

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_595292.1 Gene:pac1 / 2540084 PomBaseID:SPBC119.11c Length:363 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:46/191 - (24%)
Similarity:74/191 - (38%) Gaps:17/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 HNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLG---TKDLIQST 175
            ||..|...|......:....:..:.|::....|..:.:..:..|:....:...|   |..|..|.
pombe   170 HNERLEFLGDSFFNLFTTRIIFSKFPQMDEGSLSKLRAKFVGNESADKFARLYGFDKTLVLSYSA 234

  Fly   176 EYPPSAESQ---AKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKI 237
            |.....:||   |.:..|.:|||......|.||.:|     ::|.|..:..: |.|.||..|.|.
pombe   235 EKDQLRKSQKVIADTFEAYLGALILDGQEETAFQWV-----SRLLQPKIANI-TVQRPIDKLAKS 293

  Fly   238 CQERK---LGEAEPRLLGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQ 295
            ....|   ||..|.|.:...|.:.  ..|.:....|.:.:.:.:|.:.|.|...||:.||:
pombe   294 KLFHKYSTLGHIEYRWVDGAGGSA--EGYVIACIFNGKEVARAWGANQKDAGSRAAMQALE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 46/191 (24%)
RIBOc 81..219 CDD:197778 24/110 (22%)
pac1NP_595292.1 Rnc 136..359 CDD:223644 46/191 (24%)
RIBOc 141..282 CDD:238333 25/117 (21%)
DSRM 291..354 CDD:214634 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.