DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and pac1

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_595292.1 Gene:pac1 PomBaseID:SPBC119.11c Length:363 Species:Schizosaccharomyces pombe

Alignment Length:191 Identity:46/192 (24%)
Similarity:74/192 (39%) Gaps:17/192 (9%)


  Fly   114 HNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLG---TKDLIQST 175
            ||..|...|......:....:..:.|::....|..:.:..:..|:....:...|   |..|..|.
pombe   170 HNERLEFLGDSFFNLFTTRIIFSKFPQMDEGSLSKLRAKFVGNESADKFARLYGFDKTLVLSYSA 234

  Fly   176 EYPPSAESQ---AKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKI 237
            |.....:||   |.:..|.:|||......|.||.:|     ::|.|..:..: |.|.||..|.|.
pombe   235 EKDQLRKSQKVIADTFEAYLGALILDGQEETAFQWV-----SRLLQPKIANI-TVQRPIDKLAKS 293

  Fly   238 CQERK---LGEAEPRLLGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQ 295
            ....|   ||..|.|.:...|.:.  ..|.:....|.:.:.:.:|.:.|.|...||:.||:
pombe   294 KLFHKYSTLGHIEYRWVDGAGGSA--EGYVIACIFNGKEVARAWGANQKDAGSRAAMQALE 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 46/192 (24%)
RIBOc 81..219 CDD:197778 25/111 (23%)
pac1NP_595292.1 Rnc 136..359 CDD:223644 46/192 (24%)
RIBOc 141..282 CDD:238333 25/118 (21%)
DSRM 291..354 CDD:214634 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11207
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.