DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL44 and Drosha

Sequence 1:NP_649541.1 Gene:mRpL44 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_006520084.1 Gene:Drosha MGIID:1261425 Length:1393 Species:Mus musculus

Alignment Length:275 Identity:66/276 (24%)
Similarity:109/276 (39%) Gaps:30/276 (11%)


  Fly    35 PTLRE--LAHRQKKLGPQKPERRSGFVEWNQ-RSELFAFGKRLGESF-ELSELQRAFTEKSFAER 95
            |.|||  |.:....|..|:|......:|.:. ..:|..|.:.:|..| .:..|.||||       
Mouse  1091 PDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFT------- 1148

  Fly    96 EEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLA 160
                .|.:|.  :.|.:.||..:...|..|.:.....:|....|......|..:.|.|::..|.|
Mouse  1149 ----LRTVGF--NHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQA 1207

  Fly   161 HVSTHLGTKDLI---QSTEYPPSAESQ--AKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKD 220
            .|:..||.::..   ..|:.|.:..::  |..|.:.|.||.....:|....|:......:|.:..
Mouse  1208 KVAEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFI 1272

  Fly   221 LLEVWTPQEPIQLLEKICQERKLGEAEP-----RLLGDCGKNTVLAAYQVGIYANRQLLGKGFGE 280
            |.:.|  .:|...|::.|...:....||     :.|...|.:.. ..|.|.:|...:.:|.|.|.
Mouse  1273 LNQDW--NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHA-RTYTVAVYFKGERIGCGKGP 1334

  Fly   281 DVKTATETAALDALQ 295
            .::.|...||:|||:
Mouse  1335 SIQQAEMGAAMDALE 1349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 55/236 (23%)
RIBOc 81..219 CDD:197778 32/143 (22%)
DroshaXP_006520084.1 PRP38_assoc 229..309 CDD:289628
DUF1777 237..>347 CDD:285811
RIBOc 978..1098 CDD:238333 4/7 (57%)
rnc 1124..1352 CDD:234633 57/243 (23%)
RIBOc 1141..1273 CDD:238333 32/145 (22%)
DSRM 1280..1351 CDD:214634 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.