DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLDIP2 and Fbxo3

DIOPT Version :9

Sequence 1:NP_730934.1 Gene:POLDIP2 / 40655 FlyBaseID:FBgn0037329 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001103076.1 Gene:Fbxo3 / 690634 RGDID:1593433 Length:480 Species:Rattus norvegicus


Alignment Length:165 Identity:51/165 - (30%)
Similarity:78/165 - (47%) Gaps:29/165 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 TTENVRITVIPFYMGCRETPASSV----YWWRYCIRLE----NLGELSVQLRERHWRIFSLSGTL 345
            ||.::.::|...::    ...|||    |::.|.||:|    .|.|.:.||..|:|||.:..|.:
  Rat   280 TTGDITVSVSTSFL----PELSSVHPPHYFFTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDV 340

  Fly   346 ETVRGRGVVGQEPILSP-RLPAFQYSSHVSLQAPSGHMWG--TFRLEREDGYSFDCKIPPF---- 403
            |.|:|.||||:.||:|| |:  ::|:|..:....||:|.|  ||.........|:..||.|    
  Rat   341 EEVQGPGVVGEFPIISPGRI--YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKVFNVAIPRFHMAC 403

  Fly   404 --------SLESKPDDLGTPTPATPSAHDKKRDDS 430
                    .||..||:............:::.|||
  Rat   404 PTFRVSIARLEMGPDEYEEMEEEAEEEEEEENDDS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POLDIP2NP_730934.1 YccV-like 72..258 CDD:294919
DUF525 308..390 CDD:282262 37/92 (40%)
Fbxo3NP_001103076.1 F-box-like 13..57 CDD:403981
SMI1_KNR4 121..249 CDD:401332
DUF525 294..383 CDD:398192 36/90 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..464 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.