DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Orco and Or33a

Sequence 1:NP_001097687.1 Gene:Orco FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster

Alignment Length:364 Identity:70/365 (19%)
Similarity:146/365 (40%) Gaps:72/365 (20%)


  Fly   179 LPIKSFYPWN--ASHGMFYMISFAFQIYYVL----------FSMIHSNLCDVMFCSWLIFA---- 227
            |.::..||:.  ....:...|:..|.::.:|          |..:|.. .:.:|||:..|.    
  Fly    23 LGVEGDYPFRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSLHFT-SECLFCSYKFFCFRWK 86

  Fly   228 CEQLQHLKGIMKPL---MELSASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYS 289
            .::::.::|:::.|   :|.....:.:..|.:.:.|.|   |||.|:  ..........::|::|
  Fly    87 LKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARML---SKSYLV--AAISAIITATVAGLFS 146

  Fly   290 SKAD-----W-GAQFRAPSTLQ--SFGGNGGGGN-----GLVNGANP-------NGLTKKQEMMV 334
            :..:     | ...|:|.:.:.  ||.....|.:     .|.|.:.|       :|..:...|.:
  Fly   147 TGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRL 211

  Fly   335 RSAIKYWVE--RHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGY 397
             |.|.:.|:  ..::..:|:..|.|......::.:|.||:.|:.|....:  :|:|: :.|::..
  Fly   212 -SRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLS--SGINI-SITLINI 272

  Fly   398 LGYA----------------LAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVC 446
            |.:|                |.::|..|.:|..:..|...:..|.:|.:|....:.....:.|:.
  Fly   273 LFFAENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILM 337

  Fly   447 QQCQKAMSISGAKFFTVSLDL---FASVLGAVVTYFMVL 482
            |.....::|.....  |.:|:   ||:|..|...|.:.|
  Fly   338 QLTLVPVNIKAGGI--VGIDMSAFFATVRMAYSFYTLAL 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 67/353 (19%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 62/318 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.