DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and ZNF276

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001106997.1 Gene:ZNF276 HGNCID:23330 Length:614 Species:Homo sapiens

Alignment Length:278 Identity:55/279 (20%)
Similarity:91/279 (33%) Gaps:55/279 (20%)


  Fly    80 DIIKKTSDQSTVHVELSSEPLDEQL--------IDADQLETHYDDDQYVCYQGTKEEHQDLEEIE 136
            |:.:..||...|... |..|....|        :...||.:...||:      .|:|..||.|.:
Human   306 DVAQPPSDSDAVGPR-SGFPPQPSLPLCRAPGQLGEKQLPSSTSDDR------VKDEFSDLSEGD 363

  Fly   137 L-------------DDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRS-------------- 174
            :             ..|.|.......:.:.:.::.::.::.|..|..|:..              
Human   364 VLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCERE 428

  Fly   175 ---NFFIC--DECGTLFHDAFLYTEHLNGHQNR-RDMNQFFPCPE--CPQTFNKKALLKQHRTQV 231
               ..:.|  ..|..::..|....:|:..|... |:.    |||.  |.:.|.....|::|...:
Human   429 ELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRER----PCPHPGCNKVFMIDRYLQRHVKLI 489

  Fly   232 HLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIR-KF 295
            |...|.:.|..|.:.|......|.|...|...:|..|..||......:.|:.|.:.|..:.. .|
Human   490 HTEVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAETELDF 554

  Fly   296 RCEPCNMDFITRRGLVAH 313
            .|:.|...|.....|..|
Human   555 ACDQCGRRFEKAHNLNVH 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 55/279 (20%)
C2H2 Zn finger 179..199 CDD:275368 4/22 (18%)
C2H2 Zn finger 211..232 CDD:275368 6/23 (26%)
C2H2 Zn finger 240..260 CDD:275368 5/20 (25%)
zf-C2H2_8 243..313 CDD:292531 17/71 (24%)
C2H2 Zn finger 268..288 CDD:275368 5/20 (25%)
C2H2 Zn finger 297..316 CDD:275368 5/18 (28%)
ZNF276NP_001106997.1 zf-AD 79..155 CDD:285071
C2H2 Zn finger 470..490 CDD:275368 4/20 (20%)
zf-C2H2 496..518 CDD:278523 5/22 (23%)
C2H2 Zn finger 498..518 CDD:275368 5/20 (25%)
C2H2 Zn finger 526..546 CDD:275368 5/20 (25%)
C2H2 Zn finger 556..573 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.