DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and DOT5

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana

Alignment Length:139 Identity:30/140 (21%)
Similarity:45/140 (32%) Gaps:39/140 (28%)


  Fly   209 FPCPECPQTFNKKALLKQHR----------------TQVHLINRRFQCTICHEA----------- 246
            |.|..|.:|||:...::.|.                |:......|..|..|.|.           
plant   101 FSCSVCNKTFNRFNNMQMHMWGHGSQYRKGPESLRGTKSSSSILRLPCYCCAEGCKNNIDHPRSK 165

  Fly   247 ----FASLGAKLRHDKAHKNERPYPC-LECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFIT 306
                |.:|..   |.|.....:|:.| .:|...|:    ::..:.||.|...|.....|..||..
plant   166 PLKDFRTLQT---HYKRKHGAKPFRCRKKCEKTFA----VRGDWRTHEKNCGKLWFCVCGSDFKH 223

  Fly   307 RRGLVAHTK 315
            :|.|..|.:
plant   224 KRSLKDHVR 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368
C2H2 Zn finger 211..232 CDD:275368 7/37 (19%)
C2H2 Zn finger 240..260 CDD:275368 7/35 (20%)
zf-C2H2_8 243..313 CDD:292531 19/86 (22%)
C2H2 Zn finger 268..288 CDD:275368 4/21 (19%)
C2H2 Zn finger 297..316 CDD:275368 6/20 (30%)
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.