DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and prdm15

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_009303772.1 Gene:prdm15 ZFINID:ZDB-GENE-080618-4 Length:1120 Species:Danio rerio

Alignment Length:355 Identity:77/356 (22%)
Similarity:130/356 (37%) Gaps:75/356 (21%)


  Fly     7 CRICANKIMGHQRDRN--IFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELD-----LA 64
            |.|| .|:...:.:.|  :..|...||..:                  :|.|.|..:|     :.
Zfish   500 CPIC-GKVFSCRSNMNKHLLTHGDKKYTCE------------------ICGRKFFRVDVLRDHIH 545

  Fly    65 TKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVC-------- 121
            ..|::..:..::...|.|||..    :.:|.|.:..||:  |......|:   :|.|        
Zfish   546 VHFKDIALMDEQEREDFIKKIG----ISMEESDDSSDEE--DEKNDPEHH---KYSCKKCQVTFA 601

  Fly   122 -----YQGTKEEHQDL--------EEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQEM-ERAAKR 172
                 .:...|.|::.        ....|....:|.::...:...:.|.|:.:...|| .|....
Zfish   602 KGRDYLKHIMEMHKEKGYNCTMCNRRFALKATYNAHLVIHRDHLPDPAVQKYIHPCEMCGRIFNS 666

  Fly   173 RSNF------------FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLK 225
            ..|.            ..|::||..|....:..|||..|.|.||    |.|.||.:....|..|:
Zfish   667 IGNLDRHKIIHTGVKSHCCEQCGKSFARKDMLKEHLRVHDNVRD----FLCAECGKGMKTKHALR 727

  Fly   226 QHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSK 290
             |..::|...:.::|..|:..||.....|:|.|.|...:.:.|..||..||..:.::.|...|:.
Zfish   728 -HHMKLHKGIKEYECKECNRKFAQKVNMLKHYKRHTGTKDFMCELCGKTFSERNTMETHKLIHTV 791

  Fly   291 QIRKFRCEPCNMDFITRRGLVAHTKTAPHK 320
            . :.|.|..|:..::|:..|..||:....|
Zfish   792 G-KTFSCSVCDKKYVTQYMLQKHTQLTHEK 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 13/80 (16%)
C2H2 Zn finger 179..199 CDD:275368 7/20 (35%)
C2H2 Zn finger 211..232 CDD:275368 6/21 (29%)
C2H2 Zn finger 240..260 CDD:275368 7/20 (35%)
zf-C2H2_8 243..313 CDD:292531 19/70 (27%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)
prdm15XP_009303772.1 COG5048 312..807 CDD:227381 73/341 (21%)
zf-C2H2 334..356 CDD:278523
C2H2 Zn finger 336..356 CDD:275368
C2H2 Zn finger 363..413 CDD:275368
zf-C2H2 422..444 CDD:278523
C2H2 Zn finger 424..444 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 500..520 CDD:275368 5/21 (24%)
C2H2 Zn finger 527..547 CDD:275368 4/38 (11%)
C2H2 Zn finger 621..644 CDD:275368 2/23 (9%)
C2H2 Zn finger 657..677 CDD:275368 4/20 (20%)
zf-H2C2_2 669..694 CDD:290200 5/25 (20%)
C2H2 Zn finger 685..705 CDD:275368 7/20 (35%)
C2H2 Zn finger 713..733 CDD:275368 6/21 (29%)
C2H2 Zn finger 741..761 CDD:275368 7/20 (35%)
C2H2 Zn finger 769..789 CDD:275368 6/20 (30%)
C2H2 Zn finger 797..818 CDD:275368 6/21 (29%)
C2H2 Zn finger 826..844 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.