DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and Repin1

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006236485.1 Gene:Repin1 RGDID:1549707 Length:639 Species:Rattus norvegicus

Alignment Length:186 Identity:53/187 (28%)
Similarity:75/187 (40%) Gaps:19/187 (10%)


  Fly   141 PSAAVIAAAEAAAEAAQQED----------LQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEH 195
            |..::...|||.|......|          |:..:.:...:|.   |.|.|||..|........|
  Rat   432 PLGSLRTPAEAPASLHSCTDCGRSFRLERFLRLHQRQHTGERP---FTCTECGKNFGKKTHLVAH 493

  Fly   196 LNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAH 260
            ...|...|.    |.|.||.:.|::.:.|..||.. |...|.|.|..|.:||........|.:.|
  Rat   494 SRVHSGERP----FACEECGRRFSQGSHLAAHRRD-HAPERPFVCPDCGKAFRHKPYLAAHRRIH 553

  Fly   261 KNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKT 316
            ..|:||.|.:||..||..|.|.:|...|:.: |.:.|..|:..|..:..|:.|.|:
  Rat   554 TGEKPYVCPDCGKAFSQKSNLVSHRRIHTGE-RPYACPDCDRSFSQKSNLITHRKS 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 6/20 (30%)
C2H2 Zn finger 211..232 CDD:275368 7/21 (33%)
C2H2 Zn finger 240..260 CDD:275368 5/20 (25%)
zf-C2H2_8 243..313 CDD:292531 22/70 (31%)
C2H2 Zn finger 268..288 CDD:275368 8/20 (40%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)
Repin1XP_006236485.1 C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 174..194 CDD:275368
C2H2 Zn finger 205..225 CDD:275368
COG5048 <225..399 CDD:227381
C2H2 Zn finger 234..254 CDD:275368
C2H2 Zn finger 266..286 CDD:275368
C2H2 Zn finger 325..345 CDD:275368
zf-H2C2_2 337..362 CDD:290200
COG5048 <341..612 CDD:227381 53/187 (28%)
C2H2 Zn finger 353..373 CDD:275368
zf-H2C2_2 365..390 CDD:290200
C2H2 Zn finger 381..401 CDD:275368
C2H2 Zn finger 449..469 CDD:275368 2/20 (10%)
zf-H2C2_2 462..484 CDD:290200 7/25 (28%)
C2H2 Zn finger 477..497 CDD:275368 6/20 (30%)
zf-H2C2_2 489..514 CDD:290200 8/29 (28%)
C2H2 Zn finger 505..525 CDD:275368 7/21 (33%)
C2H2 Zn finger 533..553 CDD:275368 5/20 (25%)
zf-H2C2_2 545..570 CDD:290200 10/25 (40%)
C2H2 Zn finger 561..581 CDD:275368 8/20 (40%)
zf-H2C2_2 573..598 CDD:290200 7/26 (27%)
C2H2 Zn finger 589..609 CDD:275368 6/21 (29%)
C2H2 Zn finger 617..637 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209720400
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.