DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and CG1792

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster

Alignment Length:352 Identity:89/353 (25%)
Similarity:147/353 (42%) Gaps:63/353 (18%)


  Fly     7 CRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQG--LPEIVCERCFSELDLATKFRE 69
            ||.|...|. .....|:|.......|.|::::||:.|....|  ||..:|..|..:|..|..|||
  Fly     6 CRTCGLFIF-CSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRE 69

  Fly    70 RCIFSQKYL--------LDIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTK 126
            |.|.:||.|        .::|:..:......::.:.|..:.::||.                 ..
  Fly    70 RVIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDL-----------------LP 117

  Fly   127 EEH--QDLEE----IELDDDPSAAVIA---------------------AAEAAAEAAQQEDLQEQ 164
            |||  ::.||    .|.::.|...|.|                     |..:.|...|...|.|.
  Fly   118 EEHLLEETEEPYEICEQNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTED 182

  Fly   165 EMERAAK-RRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHR 228
            |:....: ||....||::||..|.....:..||..|...:.    |.|.:|.|.|....||::|:
  Fly   183 EVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKS----FACDQCSQQFYTATLLRRHQ 243

  Fly   229 TQVHLINRRFQCTICHEAFASLGAKLRHDK-AHKNERPYPCLECGMIFSSVSELQNHFSTHSKQI 292
             ::|..|..|||..|...:::...:::|:: .|.|.:|:.|.||...|:...:|:.|..:|: .:
  Fly   244 -ELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHT-GV 306

  Fly   293 RKFRCEPCNMDFITRRGLVAHTKTAPH 319
            |.|.|:.|.:.|:.|..|.:|.::..|
  Fly   307 RAFHCDSCQVSFVRRSHLTSHYRSKGH 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 26/83 (31%)
C2H2 Zn finger 179..199 CDD:275368 6/20 (30%)
C2H2 Zn finger 211..232 CDD:275368 7/21 (33%)
C2H2 Zn finger 240..260 CDD:275368 3/21 (14%)
zf-C2H2_8 243..313 CDD:292531 19/71 (27%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/75 (35%)
C2H2 Zn finger 198..218 CDD:275368 6/20 (30%)
C2H2 Zn finger 226..243 CDD:275368 7/17 (41%)
C2H2 Zn finger 254..275 CDD:275368 3/21 (14%)
zf-C2H2 281..303 CDD:278523 6/22 (27%)
C2H2 Zn finger 283..303 CDD:275368 6/20 (30%)
zf-H2C2_2 296..320 CDD:290200 8/25 (32%)
C2H2 Zn finger 311..329 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.