DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and CG31365

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:368 Identity:81/369 (22%)
Similarity:133/369 (36%) Gaps:93/369 (25%)


  Fly    38 ITGVELTRNQGLPEIVCE--RCFSELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPL 100
            |.|:||..     |:..|  ..|.|:::...             |::.  :|...:::..|:...
  Fly   296 IDGLELDE-----EVPAESGEDFREINMVGS-------------DVVH--TDNGEIYIINSASSE 340

  Fly   101 DEQL-----IDADQLETHYD--DDQYVCYQGTK-EEHQDLEEIELDDDPS--AAVIAAAEAAAEA 155
            |:..     .|.|...|.|:  :|..:.:.|.| ||.:|:....|.::.|  ..|.:..|.....
  Fly   341 DQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIV 405

  Fly   156 AQQEDLQEQEMERAAKRRSNF----------------------FICDECGTLFHDAFLYTEHLNG 198
            .::::.::::.....||.|..                      |.|..|...|....|.|.|.|.
  Fly   406 EKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNT 470

  Fly   199 H-------------------------QNRRDM-----NQFFPCPECPQTFNKKALLKQHRTQVHL 233
            |                         ..:|.|     .:.|.|.||..:|:::.:||:| ...|.
  Fly   471 HIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRH-MDTHT 534

  Fly   234 INRRFQCTICHEAFASLGAKLRH-DKAHK-NERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFR 296
            ..:|.||..|...||......:| .:.|. |.|.:.|..|...|:.||.|..|..||:..:  |.
  Fly   535 GVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM--FS 597

  Fly   297 CEPCNMDFITRRGLVAHTKTAPHK---RLAKYMQDEFDFIELA 336
            |:.|...|..|..:..|. |..||   :|..|:.:..:|..:|
  Fly   598 CKQCGRQFNDRSAVQRHV-TTMHKVKNKLTDYISETNEFQAVA 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 8/44 (18%)
C2H2 Zn finger 179..199 CDD:275368 7/20 (35%)
C2H2 Zn finger 211..232 CDD:275368 7/21 (33%)
C2H2 Zn finger 240..260 CDD:275368 5/21 (24%)
zf-C2H2_8 243..313 CDD:292531 21/72 (29%)
C2H2 Zn finger 268..288 CDD:275368 8/20 (40%)
C2H2 Zn finger 297..316 CDD:275368 5/19 (26%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 17/77 (22%)
C2H2 Zn finger 485..505 CDD:275368 2/20 (10%)
zf-H2C2_2 497..522 CDD:290200 7/25 (28%)
C2H2 Zn finger 513..533 CDD:275368 7/21 (33%)
zf-H2C2_2 526..550 CDD:290200 10/25 (40%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.