DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and CG14710

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster

Alignment Length:413 Identity:91/414 (22%)
Similarity:159/414 (38%) Gaps:122/414 (29%)


  Fly     7 CRICANK--------IMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDL 63
            ||||...        :.|.:.:.:    :|.|    |:|...:.:.::..|||..|..|...:.:
  Fly    10 CRICLGDFEESQMICLFGDKGESD----LRKK----LELCCRIRVRQSPQLPEKACNSCCEFVQM 66

  Fly    64 ATKFRERCIFSQKY-------LLDIIKKTSD-------QSTVHVELSSEPLDEQLIDADQLETHY 114
            ...||:.|:.||.|       ..:.:.:.||       ...:|::|.:|..:::.|.|.:.....
  Fly    67 WFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQ 131

  Fly   115 DDDQYVCYQGTKEEHQDL------EEIELDDDPSA-----AVIAAAEAAAEAAQQEDLQE----- 163
            .:||       .:|..|.      |.||.|::|:.     .:|:..::..:..|.|:|.:     
  Fly   132 QEDQ-------SQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGEL 189

  Fly   164 -QEMERA--------------------------------------------------AKRRSN-- 175
             :|:..|                                                  ||.|.|  
  Fly   190 VEELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQP 254

  Fly   176 ------FFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFP--CPECPQTFNKKALLKQHRTQVH 232
                  .|:|..||.:|:...::|.|:..|      :::.|  |..|.::|.:...|:.| .:.|
  Fly   255 KCKEEEKFMCILCGNVFYKKSVFTAHMMTH------SEYKPHQCEICNKSFRQMGELRAH-IRRH 312

  Fly   233 LINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRC 297
            ..:|.::|..|...|.....::||::.|.|.|||.|.|||..|:..:.|:||..:||.| :.:.|
  Fly   313 TGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQ-KNYNC 376

  Fly   298 EPCNMDFITRRGLVAHTKTAPHK 320
            ..|...|.....|.||.:|..|:
  Fly   377 GICCKSFTLLHQLKAHLQTLTHR 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 20/88 (23%)
C2H2 Zn finger 179..199 CDD:275368 6/20 (30%)
C2H2 Zn finger 211..232 CDD:275368 5/21 (24%)
C2H2 Zn finger 240..260 CDD:275368 5/20 (25%)
zf-C2H2_8 243..313 CDD:292531 25/70 (36%)
C2H2 Zn finger 268..288 CDD:275368 8/20 (40%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 20/81 (25%)
COG5048 <261..395 CDD:227381 43/142 (30%)
C2H2 Zn finger 264..284 CDD:275368 6/20 (30%)
zf-C2H2 290..312 CDD:278523 5/23 (22%)
C2H2 Zn finger 292..312 CDD:275368 5/21 (24%)
zf-H2C2_2 304..327 CDD:290200 6/24 (25%)
C2H2 Zn finger 320..340 CDD:275368 5/20 (25%)
zf-H2C2_2 335..357 CDD:290200 12/22 (55%)
C2H2 Zn finger 348..368 CDD:275368 8/20 (40%)
C2H2 Zn finger 376..395 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.