| Sequence 1: | NP_001014607.1 | Gene: | CG14667 / 40643 | FlyBaseID: | FBgn0037317 | Length: | 337 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011240774.1 | Gene: | Zfp810 / 235050 | MGIID: | 2384563 | Length: | 466 | Species: | Mus musculus |
| Alignment Length: | 254 | Identity: | 62/254 - (24%) |
|---|---|---|---|
| Similarity: | 106/254 - (41%) | Gaps: | 30/254 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 78 LLDIIKKTSDQSTVHVELSSEPLDEQLIDADQL--------ETHYDDDQY---VCYQG--TKEEH 129
Fly 130 QDLEEIELDDDPSAAVIAAAEAAAEAAQQEDL--QEQEMERAAKRRSNFFICDECGTLFHDAFLY 192
Fly 193 TEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHD 257
Fly 258 KAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKT 316 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14667 | NP_001014607.1 | zf-AD | 6..80 | CDD:214871 | 1/1 (100%) |
| C2H2 Zn finger | 179..199 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 211..232 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 5/19 (26%) | ||
| zf-C2H2_8 | 243..313 | CDD:292531 | 21/69 (30%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 297..316 | CDD:275368 | 6/18 (33%) | ||
| Zfp810 | XP_011240774.1 | KRAB | 4..59 | CDD:214630 | |
| C2H2 Zn finger | 133..153 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 161..181 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 9/23 (39%) | ||
| COG5048 | <199..373 | CDD:227381 | 36/124 (29%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 329..349 | CDD:275368 | |||
| C2H2 Zn finger | 357..377 | CDD:275368 | |||
| zf-H2C2_2 | 369..392 | CDD:372612 | |||
| C2H2 Zn finger | 385..405 | CDD:275368 | |||
| zf-H2C2_2 | 398..420 | CDD:372612 | |||
| C2H2 Zn finger | 413..433 | CDD:275368 | |||
| C2H2 Zn finger | 441..461 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||