DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and Zfp810

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_011240774.1 Gene:Zfp810 MGIID:2384563 Length:466 Species:Mus musculus

Alignment Length:254 Identity:62/255 (24%)
Similarity:106/255 (42%) Gaps:30/255 (12%)


  Fly    78 LLDIIKKTSDQSTVHVELSSEPLDEQLIDADQL--------ETHYDDDQY---VCYQG--TKEEH 129
            |:|.|::...:....:|::|...:|:|::..::        |.|.....|   ||.:.  .|.::
Mouse    82 LVDTIQENDSRHFWQIEINSHTANEELVEVGKIDAELKIHEEIHRGAKSYECEVCLEAFYLKPQY 146

  Fly   130 QDLEEIELDDDPSAAVIAAAEAAAEAAQQEDL--QEQEMERAAKRRSNFFICDECGTLFHDAFLY 192
            ...:.....::|     ...:...||...:..  |.|.:||..|..:    |.|||    .:|..
Mouse   147 STKQSYHTCENP-----CDCKKCREAFYPKSTLSQYQRLERGEKPHA----CLECG----KSFYC 198

  Fly   193 TEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHD 257
            ..||..||......:.:.|.||.:.|..|:.|..| .::|...:.::|..|.:||........|.
Mouse   199 KSHLTVHQRTHTGEKPYDCKECRKAFYSKSQLNVH-LRIHTGEKPYECKDCRKAFYRNSDLTVHQ 262

  Fly   258 KAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKT 316
            :.|..|:||.|..|...|...|:|..|..||:.: :.:.|:.||..|..:..|..|.:|
Mouse   263 RTHTGEKPYECKVCRKAFYCNSQLTVHHRTHTGE-KPYECQVCNKAFYCKSQLAVHHRT 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 1/2 (50%)
C2H2 Zn finger 179..199 CDD:275368 7/20 (35%)
C2H2 Zn finger 211..232 CDD:275368 7/21 (33%)
C2H2 Zn finger 240..260 CDD:275368 5/20 (25%)
zf-C2H2_8 243..313 CDD:292531 21/70 (30%)
C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)
Zfp810XP_011240774.1 KRAB 4..59 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 133..153 CDD:275368 3/20 (15%)
C2H2 Zn finger 161..181 CDD:275368 4/20 (20%)
C2H2 Zn finger 189..209 CDD:275368 9/24 (38%)
COG5048 <199..373 CDD:227381 36/125 (29%)
zf-H2C2_2 201..224 CDD:290200 7/23 (30%)
C2H2 Zn finger 217..237 CDD:275368 7/21 (33%)
zf-H2C2_2 230..254 CDD:290200 7/25 (28%)
C2H2 Zn finger 245..265 CDD:275368 5/20 (25%)
zf-H2C2_2 257..280 CDD:290200 7/23 (30%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 286..308 CDD:290200 7/23 (30%)
C2H2 Zn finger 301..321 CDD:275368 7/21 (33%)
zf-H2C2_2 314..336 CDD:290200 3/8 (38%)
C2H2 Zn finger 329..349 CDD:275368
zf-H2C2_2 341..366 CDD:290200
C2H2 Zn finger 357..377 CDD:275368
zf-H2C2_2 369..392 CDD:290200
C2H2 Zn finger 385..405 CDD:275368
zf-H2C2_2 398..420 CDD:290200
C2H2 Zn finger 413..433 CDD:275368
C2H2 Zn finger 441..461 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.