DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14667 and znf1014

Sequence 1:NP_001014607.1 Gene:CG14667 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001108370.1 Gene:znf1014 ZFINID:ZDB-GENE-080220-9 Length:508 Species:Danio rerio

Alignment Length:322 Identity:72/323 (22%)
Similarity:117/323 (36%) Gaps:93/323 (29%)


  Fly    35 LKLITGVELTRNQGLPEIVCERCFSELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEP 99
            ||...|:.:    ||....|..|      ...||             ||.:.:   ||:.|    
Zfish    79 LKQHIGIHI----GLKPFACAEC------GKSFR-------------IKSSLE---VHMRL---- 113

  Fly   100 LDEQLIDADQLETHYDDDQYVC--------YQGTKEEHQDLEEIELDDDPSAAVIAAAEAAAEAA 156
                         |..:..:.|        ..||.::||   .|..::.|    ....|......
Zfish   114 -------------HTGEKPFTCSLCGKSFRRSGTFDDHQ---RIHFEEKP----FTCDECGKSFK 158

  Fly   157 QQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRR------------------ 203
            ....||..::..:.::.   |.||:||..:.......:|:..|.|.:                  
Zfish   159 WANCLQIHKLIHSGEKP---FGCDQCGKRYIQKSELRDHMMSHTNEKPYSCEFCGKGFARLCRFR 220

  Fly   204 -------DMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHK 261
                   .:|: :.|.:|.|||....|||.|: ::|...|.::|..|.:.|...||..:|.:.|.
Zfish   221 HHQKTHTGVNE-YSCTDCGQTFTTFTLLKAHQ-KIHTEKRPYKCAFCQKTFKQSGAFKKHHRIHS 283

  Fly   262 NERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGL----VAHTKTAPH 319
            .|:|:.|.|||..|...:.||.|...||.: ::|.|:.|...|:.:..|    ::||...|:
Zfish   284 EEKPFACDECGKSFKWENSLQIHKLIHSGE-KQFSCDQCGKKFVQKSDLKTHMMSHTGEKPY 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 9/45 (20%)
C2H2 Zn finger 179..199 CDD:275368 5/20 (25%)
C2H2 Zn finger 211..232 CDD:275368 9/21 (43%)
C2H2 Zn finger 240..260 CDD:275368 6/20 (30%)
zf-C2H2_8 243..313 CDD:292531 23/74 (31%)
C2H2 Zn finger 268..288 CDD:275368 8/20 (40%)
C2H2 Zn finger 297..316 CDD:275368 6/23 (26%)
znf1014NP_001108370.1 C2H2 Zn finger 66..86 CDD:275368 3/7 (43%)
COG5048 90..476 CDD:227381 67/308 (22%)
C2H2 Zn finger 94..114 CDD:275368 9/59 (15%)
C2H2 Zn finger 122..142 CDD:275368 6/23 (26%)
C2H2 Zn finger 150..170 CDD:275368 3/20 (15%)
C2H2 Zn finger 178..198 CDD:275368 5/20 (25%)
C2H2 Zn finger 206..226 CDD:275368 0/20 (0%)
C2H2 Zn finger 234..254 CDD:275368 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 6/20 (30%)
C2H2 Zn finger 290..310 CDD:275368 8/20 (40%)
C2H2 Zn finger 318..338 CDD:275368 4/20 (20%)
C2H2 Zn finger 346..366 CDD:275368
C2H2 Zn finger 374..394 CDD:275368
C2H2 Zn finger 402..422 CDD:275368
C2H2 Zn finger 430..450 CDD:275368
C2H2 Zn finger 458..478 CDD:275368
C2H2 Zn finger 486..503 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.