DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and PMT1

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_010188.1 Gene:PMT1 / 851462 SGDID:S000002253 Length:817 Species:Saccharomyces cerevisiae

Alignment Length:162 Identity:57/163 (35%)
Similarity:73/163 (45%) Gaps:28/163 (17%)


  Fly    25 NVVT---CGSILKLLN-SDYAFRLHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIKAQT--GELC 83
            |||.   .|||:.|.: |.....||||...|.:||.||..| :....|.|:.|:::...  ||..
Yeast   322 NVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQST-LYPHMDANNDWLLELYNAPGESL 385

  Fly    84 ERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLS----GEQEVSAYGTDGL-GDTGDHWEVVCSNE 143
            ...:.:..|:.|||.|..|:..||||....|:|    .::|||.||..|. ||..|.|.|....:
Yeast   386 TTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKK 450

  Fly   144 NWMRSA-------------HVRLRHIDTGMYL 162
            |   ||             ..||||..||.||
Yeast   451 N---SAPGVAQERVIALDTKFRLRHAMTGCYL 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 20/53 (38%)
MIR 86..138 CDD:197746 22/57 (39%)
MIR 151..>182 CDD:197746 8/13 (62%)
PMT1NP_010188.1 PMT1 26..733 CDD:224839 57/163 (35%)
PMT 54..297 CDD:280519
MIR 326..378 CDD:197746 18/53 (34%)
MIR 391..447 CDD:197746 23/56 (41%)
MIR 459..512 CDD:197746 8/22 (36%)
PMT_4TMC 533..727 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114434713
eggNOG 1 0.900 E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.