DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and Pomt1

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_445858.1 Gene:Pomt1 / 84430 RGDID:620078 Length:747 Species:Rattus norvegicus

Alignment Length:190 Identity:53/191 (28%)
Similarity:73/191 (38%) Gaps:56/191 (29%)


  Fly    44 LHSHDVKY------GSGSG-QQSVTGVEQKEDVNSHWVIKAQTGELCERG----------EPIAC 91
            ||||...|      |.||. ||.||....| |:|:.|::|       :.|          .|:..
  Rat   341 LHSHKNTYPMIYENGRGSSHQQQVTCYPFK-DINNWWIVK-------DPGRHQLVVNNPPRPVRH 397

  Fly    92 GSTVRLEHLSTKKNLHSHHFSSPLS-GEQEVSAYGTDGLG---------------DTGDHWEVVC 140
            |..|:|.|..|.:.|::|..::||| ..||||.|....:.               ...|.|:.:.
  Rat   398 GDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNQDTWKTIL 462

  Fly   141 SNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISG--QMEIVGVH---KPQHGTRWTTAE 195
            |        .||..|::|...|.:||...  |..|  |:|:||..   .|.....|...|
  Rat   463 S--------EVRFVHVNTSAILKLSGAHL--PDWGFRQLEVVGEKLSLGPHESMVWNVEE 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 16/38 (42%)
MIR 86..138 CDD:197746 19/78 (24%)
MIR 151..>182 CDD:197746 13/33 (39%)
Pomt1NP_445858.1 PMT1 22..742 CDD:224839 53/191 (28%)
PMT 42..289 CDD:280519
MIR 321..378 CDD:197746 16/38 (42%)
MIR 392..449 CDD:197746 16/57 (28%)
MIR 463..513 CDD:197746 17/61 (28%)
PMT_4TMC 542..740 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10050
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.