DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and SDF2

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_011523408.1 Gene:SDF2 / 6388 HGNCID:10675 Length:230 Species:Homo sapiens

Alignment Length:235 Identity:111/236 (47%)
Similarity:146/236 (62%) Gaps:32/236 (14%)


  Fly     4 ILLLTGL-ALVGSISRGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKE 67
            :|||.|| :.||:.|.|      ||||||::||||:.:..|||||||:|||||||||||||...:
Human     6 LLLLGGLWSAVGASSLG------VVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVD 64

  Fly    68 DVNSHWVIKAQTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQ------------- 119
            |.||:|.|:.::..:||||.||.||..:||.|::|.:|||||||:|||||.|             
Human    65 DSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQRRKQRLKGFTEEG 129

  Fly   120 ------EVSAYGTDGLGDTGDHWEVVCSNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISGQME 178
                  ||||:|.:|.||..|.|.|:|:...|:|...||.:|..|.:.|.::|..||||||||.|
Human   130 IKLRFKEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKE 194

  Fly   179 IVGVHKPQHGTRWTTAEGLFIVPKE--KSSTHDEYAHSEL 216
            :.|:.:|.....|...||:|:.|.|  |:..|    |:||
Human   195 VHGMAQPSQNNYWKAMEGIFMKPSELLKAEAH----HAEL 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 34/49 (69%)
MIR 86..138 CDD:197746 32/71 (45%)
MIR 151..>182 CDD:197746 16/31 (52%)
SDF2XP_011523408.1 MIR 22..72 CDD:197746 35/56 (63%)
MIR 83..157 CDD:197746 34/74 (46%)
MIR 159..208 CDD:197746 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1928
Hieranoid 1 1.000
Homologene 1 1.000 H5045
Inparanoid 1 1.050 222 1.000 Inparanoid score I3486
Isobase 1 0.950 0 Normalized mean entropy S2064
OMA 1 1.010
OrthoDB 1 1.010 D1534407at2759
OrthoFinder 1 1.000 FOG0002116
OrthoInspector 1 1.000 T609941
orthoMCL 1 0.900 OOG5_129318
Panther 1 1.100 O PTHR10050
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2235
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.