DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and sdf2

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001016483.1 Gene:sdf2 / 549237 XenbaseID:XB-GENE-489307 Length:218 Species:Xenopus tropicalis

Alignment Length:213 Identity:113/214 (53%)
Similarity:147/214 (69%) Gaps:6/214 (3%)


  Fly     4 ILLLTGLALVGSISRGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKED 68
            :|.:|.|.|..||    |:|.:||||||::||||..::.|||||||:|||||||||||||...:|
 Frog    12 LLFITPLLLPVSI----ASELSVVTCGSVVKLLNIKHSVRLHSHDVRYGSGSGQQSVTGVTSVDD 72

  Fly    69 VNSHWVIKAQTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQEVSAYGTDGLGDTG 133
            .||:|.|:.||..:||||:.|.||.:|||.|::|.:|||||||:|||||.|||||:|.||.||..
 Frog    73 GNSYWRIRGQTSTVCERGKLIKCGQSVRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGDDGEGDIL 137

  Fly   134 DHWEVVCSNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISGQMEIVGVHKPQHGTRWTTAEGLF 198
            |.|.|:|..|.|.|...||.||..|.::|.::|..|||||:||.|:.|:......:.|...||:|
 Frog   138 DDWTVLCGGEFWQRDDEVRFRHTSTSVFLSVTGEQYGRPINGQREVHGMSYANQNSYWKVMEGIF 202

  Fly   199 IVPKEKSSTHDEYAHSEL 216
            :.|.|:|.|.:  .|:||
 Frog   203 MKPSEQSRTQN--IHTEL 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 34/49 (69%)
MIR 86..138 CDD:197746 33/52 (63%)
MIR 151..>182 CDD:197746 16/31 (52%)
sdf2NP_001016483.1 MIR 30..79 CDD:197746 34/49 (69%)
MIR 39..183 CDD:280906 86/144 (60%)
MIR 90..144 CDD:197746 34/54 (63%)
MIR 146..199 CDD:197746 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5045
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1534407at2759
OrthoFinder 1 1.000 FOG0002116
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.