DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and rt

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_524025.2 Gene:rt / 39297 FlyBaseID:FBgn0003292 Length:886 Species:Drosophila melanogaster

Alignment Length:232 Identity:69/233 (30%)
Similarity:99/233 (42%) Gaps:48/233 (21%)


  Fly     3 HILLLTGLALVGSISRGAATESNVVTCGSILKLLN-SDYAFR--------LHSHDVKY------- 51
            |..::|. |...|:..|.|:    :|.|..|.::: |....|        ||||...|       
  Fly   426 HDSIMTS-AFQASLDGGLAS----ITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPVRYPDK 485

  Fly    52 -GSGSGQQSVTGVEQKEDVNSHWVIKAQTGE-LCERGEP--IACGSTVRLEHLSTKKNLHSHHFS 112
             || |.||.||....| |||:.|::|..|.| |....||  |..|..::|.|..|.:.|:||..:
  Fly   486 RGS-SHQQQVTCYSFK-DVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVA 548

  Fly   113 SPLSGE-QEVSAYGTDGLGDTGD-HWEVVCSNEN-----WMR-SAHVRLRHIDTGMYLGMSGRSY 169
            :.::.: ||||.|....:...|: .|.|...|.:     |.. .:.|||.|:.|...|..|||..
  Fly   549 AAMTPQCQEVSCYIDYEIKMAGELLWRVEILNRDSEGDIWHAIKSEVRLVHVSTEASLKFSGRQL 613

  Fly   170 GRPISGQMEIV-----GVHK------PQHGTRWTTAE 195
            ......|.|:|     .:|:      .:|  |:|..|
  Fly   614 PEWGFNQHEVVADREKAIHEDAIWNVEEH--RYTQTE 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 22/66 (33%)
MIR 86..138 CDD:197746 17/56 (30%)
MIR 151..>182 CDD:197746 12/36 (33%)
rtNP_524025.2 PMT 178..421 CDD:280519
PMT1 180..877 CDD:224839 69/233 (30%)
MIR 452..508 CDD:197746 19/58 (33%)
MIR 522..578 CDD:197746 17/56 (30%)
MIR 586..642 CDD:197746 14/56 (25%)
PMT_4TMC 672..875 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114431172
eggNOG 1 0.900 E1_COG1928
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10050
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.