DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and ogm4

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_596807.1 Gene:ogm4 / 2539761 PomBaseID:SPBC16C6.09 Length:778 Species:Schizosaccharomyces pombe

Alignment Length:181 Identity:44/182 (24%)
Similarity:77/182 (42%) Gaps:43/182 (24%)


  Fly    44 LHSHDVKY-------GSGSGQQSVTGVEQKEDVNSHWV----------IKAQTGELCERGEPIAC 91
            ||||..||       ...||.|.|||. |.:|.|::|:          |:|:.      ..|:..
pombe   356 LHSHPEKYPIPYDDGRISSGGQQVTGY-QFDDENNYWMILPADHYDPPIEAKL------NVPVKN 413

  Fly    92 GSTVRLEHLSTKKNLHSHHFSSPL--SGEQEVSAYGTDGLGDTGDH--WEVVCSNEN------WM 146
            ...::|.|:.|..:|.:|..:||.  :.|:..:....:..|...::  ::||.|:..      :.
pombe   414 MDYIKLHHVGTNTDLMTHDVASPYHPTNEEFTTVSVDESAGKKHEYTLFQVVMSDNTDPQRPLYT 478

  Fly   147 RSAHVRLRHIDTGMYLGMSGRSYGRPISG----QMEIVGVHKPQHGT-RWT 192
            :::..:|.|..|.:.:.    |..:|:..    |:||.|....|.|: .||
pombe   479 KASSFKLIHKLTHVAMW----SDPKPLPDWAFKQLEINGAKNIQTGSIFWT 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 16/48 (33%)
MIR 86..138 CDD:197746 10/56 (18%)
MIR 151..>182 CDD:197746 9/35 (26%)
ogm4NP_596807.1 PMT1 37..776 CDD:224839 44/182 (24%)
PMT 63..310 CDD:280519
MIR 337..396 CDD:197746 16/41 (39%)
PMT_4TMC 549..770 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.