DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and Sdf2

DIOPT Version :8

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_033169.3 Gene:Sdf2 / 20316 MGIID:108019 Length:219 Species:Mus musculus

Alignment Length:216 Identity:110/217 (51%)
Similarity:145/217 (67%) Gaps:13/217 (6%)


  Fly     4 ILLLTGL-ALVGSISRGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKE 67
            :|||.|| :.||      |:...||||||::||||:.:..|||||||:|||||||||||||...:
Mouse    14 LLLLGGLWSAVG------ASNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVD 72

  Fly    68 DVNSHWVIKAQTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQEVSAYGTDGLGDT 132
            |.||:|.|:.:|..:||||.||.||..:||.|::|.:|||||||:|||||.|||||:|.:|.||.
Mouse    73 DSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDY 137

  Fly   133 GDHWEVVCSNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISGQMEIVGVHKPQHGTRWTTAEGL 197
            .|.|.|:|:...|:|...||.:|..|.:.|.::|..||||||||.|:.|:.:|.....|...||:
Mouse   138 LDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGI 202

  Fly   198 FIVPKE--KSSTHDEYAHSEL 216
            |:.|.|  ::..|    |:||
Mouse   203 FMKPSELLRAEVH----HAEL 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 34/49 (69%)
MIR 86..138 CDD:197746 32/52 (62%)
MIR 151..>182 CDD:197746 16/31 (52%)
Sdf2NP_033169.3 MIR 29..80 CDD:197746 34/51 (67%)
MIR 91..146 CDD:197746 34/55 (62%)
MIR 148..197 CDD:197746 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1928
Hieranoid 1 1.000
Homologene 1 1.000 H5045
Inparanoid 1 1.050 223 1.000 Inparanoid score I3490
Isobase 1 0.950 0 Normalized mean entropy S2064
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002116
OrthoInspector 1 1.000 T616751
orthoMCL 1 0.900 OOG5_129318
Panther 1 1.100 O PTHR10050
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2235
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.