powered by:
                   
 
    
    
             
          
            Protein Alignment Tim17b1 and timm23a
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_649526.2 | Gene: | Tim17b1 / 40635 | FlyBaseID: | FBgn0037310 | Length: | 179 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | XP_009305093.1 | Gene: | timm23a / 798429 | ZFINID: | ZDB-GENE-020419-17 | Length: | 232 | Species: | Danio rerio | 
        
        
        
          
            | Alignment Length: | 121 | Identity: | 29/121 - (23%) | 
          
            | Similarity: | 47/121 -  (38%) | Gaps: | 24/121 - (19%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    18 GGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARS----GLVGGNFAVWGATFSAIDC 78|..|..||    ||..:.|.|     :|...:..:...:.|:    .:|....|.|..|..::
 Zfish   105 GACFFKGA----AFGTLNGLR-----MGLSETRDMPWSKPRNVQILNMVTRQGASWANTLGSV-- 158
 
 
  Fly    79 SLVY---------FRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLAL 125:|:|         .|..||..|.:.:|..||.:..:..||..:....|:|.|:..|
 Zfish   159 ALLYSVFGVAIEKARGAEDDLNTVAAGTLTGMVFKSTGGLKGVARGGLIGLAMSGL 214
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | Tim17b1 | NP_649526.2 | Tim17 | 1..147 | CDD:295283 | 29/121 (24%) | 
          
            | timm23a | XP_009305093.1 | Tim17 | 46..215 | CDD:295283 | 29/121 (24%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG5596 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            | ZFIN | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 1.810 |  | 
        
      
           
             Return to query results.
             Submit another query.