DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and timm23a

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_009305093.1 Gene:timm23a / 798429 ZFINID:ZDB-GENE-020419-17 Length:232 Species:Danio rerio


Alignment Length:121 Identity:29/121 - (23%)
Similarity:47/121 - (38%) Gaps:24/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARS----GLVGGNFAVWGATFSAIDC 78
            |..|..||    ||..:.|.|     :|...:..:...:.|:    .:|....|.|..|..::  
Zfish   105 GACFFKGA----AFGTLNGLR-----MGLSETRDMPWSKPRNVQILNMVTRQGASWANTLGSV-- 158

  Fly    79 SLVY---------FRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLAL 125
            :|:|         .|..||..|.:.:|..||.:..:..||..:....|:|.|:..|
Zfish   159 ALLYSVFGVAIEKARGAEDDLNTVAAGTLTGMVFKSTGGLKGVARGGLIGLAMSGL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 29/121 (24%)
timm23aXP_009305093.1 Tim17 46..215 CDD:295283 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.