DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and Timm22

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_116007.1 Gene:Timm22 RGDID:68406 Length:192 Species:Rattus norvegicus

Alignment Length:127 Identity:39/128 (30%)
Similarity:53/128 (41%) Gaps:33/128 (26%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIK-------GF-----------RNAPSGLGYR 47
            |.|...|.|.|:.|..|.|.|.:    ||||....       ||           |.....:|.|
  Rat    59 MIERAMESCAFKAVLACVGGFVL----GGAFGVFTAGIDTNVGFDPKDPYRTPTAREVLKDMGQR 119

  Fly    48 LSGGLAAVRARSGLVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGL 109
               |::..:        |||:.||.||..:|.:..:|.|.|..|::|||..|||.:..|.|:
  Rat   120 ---GMSYAK--------NFAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRAGV 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 39/128 (30%)
Timm22NP_116007.1 Tim17 66..188 CDD:280604 36/121 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.