DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and Timm17al1

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_001079918.1 Gene:Timm17al1 RGDID:1560665 Length:171 Species:Rattus norvegicus

Alignment Length:141 Identity:82/142 (58%)
Similarity:105/142 (74%) Gaps:0/142 (0%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||.|||.||.:|||.|||.|||||:|.|:.:||.|.|.|::.|:..:||:
  Rat     1 MEEYAREPCPWRIVDDCYGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKNRAPQLGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |.|||..||.|||.:|..|.|||.||:|.|||.||.|||||||..:|:.||.:||.|||||||.|
  Rat    66 FVVWGGLFSTIDCGMVQIRGKEDRWNSITSGALTGAILAARTGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 IVVSHYSADSY 141
            |:::.:::..:
  Rat   131 ILLTRFASAQF 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 82/142 (58%)
Timm17al1XP_001079918.1 Tim17 1..171 CDD:295283 82/142 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.