DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and Tim17b2

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001285956.1 Gene:Tim17b2 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster

Alignment Length:178 Identity:94/179 (53%)
Similarity:126/179 (70%) Gaps:17/179 (9%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||.|||:||||||.||.:|||.||.:|||||||.|||.|::|.:||::.:|.::||:
  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            ||.|||.||.:|||||:||:||||||:|:|||.||||||:|.|..:|..||::||.||::|||:|
  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130

  Fly   131 IVVSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLA-ATYGEIDSS 177
            |..:.::|:.:|...|                .:.|.| ..||:.:||
  Fly   131 IFFTRFAAEQFRNREP----------------HIMPDANEGYGDFNSS 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 88/146 (60%)
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 89/166 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274751494
eggNOG 1 0.900 E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1516
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10485
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.