DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and timm17a

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_938181.1 Gene:timm17a ZFINID:ZDB-GENE-031030-6 Length:166 Species:Danio rerio

Alignment Length:141 Identity:87/142 (61%)
Similarity:110/142 (77%) Gaps:0/142 (0%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.|||:|||.|||:|||||:|||:.:|:.|.|.|:|.|:..:||:
Zfish     1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPSGMNHRMKGSLTAIRTRAPQLGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.|||.||..|.||||||:|.|||.||.|||||.|..:|:.||.:||.|||||||.|
Zfish    66 FAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 IVVSHYSADSY 141
            |:::.:::..:
Zfish   131 ILLTRFASAQF 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 87/142 (61%)
timm17aNP_938181.1 Tim17 1..166 CDD:295283 87/142 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274792281
eggNOG 1 0.900 E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128266
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.