DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and Tim23

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001015387.1 Gene:Tim23 FlyBaseID:FBgn0267976 Length:206 Species:Drosophila melanogaster

Alignment Length:110 Identity:26/111 (23%)
Similarity:45/111 (41%) Gaps:11/111 (10%)


  Fly    24 GALGG--GAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGNFAVWGATFSAIDCSLVYFRKK 86
            |.:||  |.:..:|..:........|.:..|..:..:..............:||....|.:||.:
  Fly    84 GGIGGLAGVYNGLKVTKALEQKGKVRRTQLLNHIMKQGSGTANTLGTLTVLYSACGVLLQFFRGE 148

  Fly    87 EDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVGI 131
            :|..|.:|:|:.||.:..:..|    |.:...|||:     |:||
  Fly   149 DDHINTVIAGSATGLLYKSTAG----LRTCAFGGAI-----GLGI 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 26/111 (23%)
Tim23NP_001015387.1 Tim17 42..188 CDD:295283 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.