DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and timm-17B.2

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_501427.2 Gene:timm-17B.2 WormBaseID:WBGene00017069 Length:140 Species:Caenorhabditis elegans

Alignment Length:53 Identity:31/54 (57%)
Similarity:35/54 (65%) Gaps:0/54 (0%)


  Fly    55 VRARSGLVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAART 107
            ||.||.|.|..||.||..||.|||.||..|||||..|:|:||..||.:||.|:
 Worm     4 VRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIRS 56

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 31/54 (57%)
timm-17B.2NP_501427.2 Tim17 <1..>56 CDD:295283 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274751813
eggNOG 1 0.900 E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.