DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and timm-17B.1

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_500627.1 Gene:timm-17B.1 WormBaseID:WBGene00017119 Length:181 Species:Caenorhabditis elegans

Alignment Length:136 Identity:73/137 (53%)
Similarity:91/137 (66%) Gaps:2/137 (1%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:||.:|.|.|||||.:||..|||..|::||..  |.:|.|.:..||.||.|.|..
 Worm     1 MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAK--GKKLVGMMREVRMRSTLTGVQ 63

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            ||.||..||.|||.||..||||||.|:|:||..||.:||.|:|...|..||::|..:||:|||||
 Worm    64 FAAWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVILAMIEGVG 128

  Fly   131 IVVSHY 136
            :|.:.:
 Worm   129 LVTTRW 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 73/137 (53%)
timm-17B.1NP_500627.1 3a0801so1tim17 1..172 CDD:130053 73/137 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274751946
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I2685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 1 1.000 T374984
orthoMCL 1 0.900 OOG5_128266
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.