DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and TIMM17A

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_006326.1 Gene:TIMM17A HGNCID:17315 Length:171 Species:Homo sapiens

Alignment Length:141 Identity:86/142 (61%)
Similarity:109/142 (77%) Gaps:0/142 (0%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.||.:|||.|||||||||:|.|:.:||.|.|.|::.|:..:||:
Human     1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.||||:|..|.||||||:|.|||.||.|||||.|..:|:.||.:||.|||||||.|
Human    66 FAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 IVVSHYSADSY 141
            |:::.:::..:
Human   131 ILLTRFASAQF 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 86/142 (61%)
TIMM17ANP_006326.1 3a0801so1tim17 1..171 CDD:130053 86/142 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274793167
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128266
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.