DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and LOC100911130

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_003752056.1 Gene:LOC100911130 RGDID:6494590 Length:172 Species:Rattus norvegicus

Alignment Length:146 Identity:90/147 (61%)
Similarity:112/147 (76%) Gaps:0/147 (0%)


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.||.:|||.|||:|||||||.|:.:|..|.:.|||.|:..:||:
  Rat     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIRHRFRGSINAVRIRAPQIGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.|||.||..|.||||||:|.|||.||.:||||:|..:|:.||::||.|||||||||
  Rat    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVG 130

  Fly   131 IVVSHYSADSYRQVSP 146
            |:::.|:|..:|...|
  Rat   131 ILLTRYTAQQFRNAPP 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 90/147 (61%)
LOC100911130XP_003752056.1 Tim17 1..171 CDD:295283 90/147 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274794883
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.