DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b1 and TIMM23

Sequence 1:NP_649526.2 Gene:Tim17b1 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_006318.1 Gene:TIMM23 HGNCID:17312 Length:209 Species:Homo sapiens

Alignment Length:132 Identity:33/133 (25%)
Similarity:50/133 (38%) Gaps:23/133 (17%)


  Fly     5 GREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARS----GLVGGN 65
            ||....|..:..|       .:.|.||.|:.|.|     ||.:.:..:|..:.|:    .:|...
Human    71 GRFELAFFTIGGC-------CMTGAAFGAMNGLR-----LGLKETQNMAWSKPRNVQILNMVTRQ 123

  Fly    66 FAVWGAT-------FSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALL 123
            .|:|..|       :||....:...|..||..|.:.:|..||.:.....||..:....|.|..|.
Human   124 GALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLT 188

  Fly   124 AL 125
            :|
Human   189 SL 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 33/133 (25%)
TIMM23NP_006318.1 3a0801s02tim23 46..191 CDD:130056 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.