DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT3G49340

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_566920.1 Gene:AT3G49340 / 824096 AraportID:AT3G49340 Length:341 Species:Arabidopsis thaliana


Alignment Length:307 Identity:111/307 - (36%)
Similarity:164/307 - (53%) Gaps:23/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 RFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKER-TGLWQRD-- 375
            ||.|.|...:|:..|..||..|||.:|.:|.|...:....:.||:|:|..|:|.| |||...:  
plant    41 RFNRVYSDDSEKTSRFEIFTNNLKFVESINMNTNKTYTLDVNEFSDLTDEEFKARYTGLVVPEGM 105

  Fly   376 -EAKATGGSAAVVPAYH--GELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGE 437
             ....|.....|...|.  ||..:..||.|:.|||.||:|..||.|||||....:||:..:..||
plant   106 TRISTTDSHETVSFRYENVGETGESMDWIQEGAVTSVKHQQQCGCCWAFSAVAAVEGMTKIANGE 170

  Fly   438 LKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAG 502
            |...|||:||||.|.::.|.||:|..|:..||:..|:..|..|||:..:..|..|. |:...::|
plant   171 LVSLSEQQLLDCSTENNGCGGGIMWKAFDYIKENQGITTEDNYPYQGAQQTCESNH-LAAATISG 234

  Fly   503 FVDLPKGNETAMQEWLLANGPISIGINANAMQF--YRGGVSHPWKALCSKKNLDHGVLVVGYGVS 565
            :..:|:.:|.|:.: .::..|:|:.|..:..:|  |.||:   :...|..: |.|.|.:||||||
plant   235 YETVPQNDEEALLK-AVSQQPVSVAIEGSGYEFIHYSGGI---FNGECGTQ-LTHAVTIVGYGVS 294

  Fly   566 DYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG----DNTCGVSEMA 608
            :     :.:.||::|||||..|||.||.|:.|.    ...||::.:|
plant   295 E-----EGIKYWLLKNSWGESWGENGYMRIMRDVDSPQGMCGLASLA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 18/50 (36%)
Peptidase_C1A 395..611 CDD:239068 82/220 (37%)
AT3G49340NP_566920.1 Inhibitor_I29 35..92 CDD:400519 18/50 (36%)
Peptidase_C1 129..340 CDD:395062 82/219 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4419
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.