DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT3G45310

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_566880.1 Gene:AT3G45310 / 823669 AraportID:AT3G45310 Length:358 Species:Arabidopsis thaliana


Alignment Length:345 Identity:116/345 - (33%)
Similarity:169/345 - (48%) Gaps:47/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 QARHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN 343
            |:||..|                      |.:|..|:|::|.|..|.::|..:|::||..|...|
plant    52 QSRHVLS----------------------FSRFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTN 94

  Fly   344 ANEMGSAKYGITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYH----GELPKEFDWRQKD 404
            ...: |.|..:.:|||:|..|:       ||.:..|....:|.:...|    ..:|...|||:..
plant    95 KKGL-SYKLSLNQFADLTWQEF-------QRYKLGAAQNCSATLKGSHKITEATVPDTKDWREDG 151

  Fly   405 AVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKA 467
            .|:.||.||.|||||.||.||.:|..|....|:....|||:|:||..|  :..|:|||...|::.
plant   152 IVSPVKEQGHCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGTFNNFGCHGGLPSQAFEY 216

  Fly   468 IKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGIN-AN 531
            ||..|||:.|..|||..|...|.|:.....|||...|::..|.|..::..:....|:|:... .:
plant   217 IKYNGGLDTEEAYPYTGKDGGCKFSAKNIGVQVRDSVNITLGAEDELKHAVGLVRPVSVAFEVVH 281

  Fly   532 AMQFYRGGVSHPWKALCSKKNLD--HGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYR 594
            ..:||:.||.  ....|....:|  |.||.|||||.|      .:|||::|||||..||:.||::
plant   282 EFRFYKKGVF--TSNTCGNTPMDVNHAVLAVGYGVED------DVPYWLIKNSWGGEWGDNGYFK 338

  Fly   595 VYRGDNTCGVSEMATSAVLA 614
            :..|.|.|||:..::..|:|
plant   339 MEMGKNMCGVATCSSYPVVA 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 19/56 (34%)
Peptidase_C1A 395..611 CDD:239068 85/220 (39%)
AT3G45310NP_566880.1 Inhibitor_I29 59..115 CDD:285458 19/56 (34%)
Peptidase_C1 141..356 CDD:278538 85/222 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.