DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT3G19400

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_566634.2 Gene:AT3G19400 / 821474 AraportID:AT3G19400 Length:362 Species:Arabidopsis thaliana


Alignment Length:315 Identity:113/315 - (35%)
Similarity:181/315 - (57%) Gaps:28/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 LFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGL 371
            ::.::.|...:.|....|::.|.:||:.|||.::|.|:....:.:.|:|.|||:|:.|::   .:
plant    43 MYEQWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEEFR---AI 104

  Fly   372 WQRDEAKATGGSAAVVPAYHGE---LPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAV 433
            :.|.:.:.|..|.......:.|   ||.|.|||...||..||:||:||||||||..|.:||:..:
plant   105 YLRKKMERTKDSVKTERYLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQI 169

  Fly   434 KTGELKEFSEQELLDCDT--TDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKK-NQCHF--NR 493
            .||||...|||||:|||.  .::.|:||:|:.|::.|...||:|.:.:|||.|.. ..|:.  |.
plant   170 TTGELISLSEQELVDCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLGLCNADKNN 234

  Fly   494 TLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGVSHPWKALCSKKNLDHG 556
            ....|.:.|:.|:|:.:|.:::: .:|:.|:|:.|.|:  |.|.|:.||   ....|. .:||||
plant   235 NTRVVTIDGYEDVPRDDEKSLKK-AVAHQPVSVAIEASSQAFQLYKSGV---MTGTCG-ISLDHG 294

  Fly   557 VLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDN----TCGVSEM 607
            |:|||||.:...:      |||::||||..||:.||.::.|..:    .||::.|
plant   295 VVVVGYGSTSGED------YWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/56 (30%)
Peptidase_C1A 395..611 CDD:239068 90/224 (40%)
AT3G19400NP_566634.2 Inhibitor_I29 44..100 CDD:214853 17/55 (31%)
Peptidase_C1 130..348 CDD:395062 91/225 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.