DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsll3

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_081620.2 Gene:Ctsll3 / 70202 MGIID:1917452 Length:331 Species:Mus musculus


Alignment Length:356 Identity:127/356 - (35%)
Similarity:185/356 - (51%) Gaps:57/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VVQA--RHTRSVE--WAEKKT-HKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNL 336
            ||.|  .|..|::  |.|.|| |||                     .|....|.|.| .::..|.
Mouse    14 VVSAAPAHNPSLDAVWEEWKTKHKK---------------------TYNMNDEGQKR-AVWENNK 56

  Fly   337 KTIEELNANEMGSAKYG----ITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYH----GE 393
            |.| :|:..:....|:|    :..|.|:|::|::|....:|..:.|      .::..:.    |:
Mouse    57 KMI-DLHNEDYLKGKHGFSLEMNAFGDLTNTEFRELMTGFQGQKTK------MMMKVFQEPLLGD 114

  Fly   394 LPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSAC 456
            :||..|||....||.||:|||||||||||..|::||....|||:|...|.|.|:||..:  :..|
Mouse   115 VPKSVDWRDHGYVTPVKDQGSCGSCWAFSAVGSLEGQMFRKTGKLVPLSVQNLVDCSWSQGNQGC 179

  Fly   457 NGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLAN 521
            :|||.|.|::.:||.|||:....|||:|....|.:|...|...|.|||:: :.:|.|:.:.:...
Mouse   180 DGGLPDLAFQYVKDNGGLDTSVSYPYEALNGTCRYNPKNSAATVTGFVNV-QSSEDALMKAVATV 243

  Fly   522 GPISIGINA--NAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYG-VSDYPNFHKTLPYWIVKNSW 583
            ||||:||:.  .:.|||:.|:.  ::..||...|||.||||||| .||      ...||:|||||
Mouse   244 GPISVGIDTKHKSFQFYKEGMY--YEPDCSSTVLDHAVLVVGYGEESD------GRKYWLVKNSW 300

  Fly   584 GPRWGEQGYYRVYRG-DNTCGVSEMATSAVL 613
            |..||..||.::.:. :|.||::..|:..|:
Mouse   301 GRDWGMNGYIKMAKDRNNNCGIASDASYPVV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 13/60 (22%)
Peptidase_C1A 395..611 CDD:239068 96/221 (43%)
Ctsll3NP_081620.2 PTZ00203 7..330 CDD:185513 126/353 (36%)
Inhibitor_I29 29..87 CDD:214853 20/80 (25%)
Peptidase_C1 115..330 CDD:278538 96/223 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.