DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AgaP_AGAP011828

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_001689282.1 Gene:AgaP_AGAP011828 / 5667926 VectorBaseID:AGAP011828 Length:344 Species:Anopheles gambiae


Alignment Length:327 Identity:125/327 - (38%)
Similarity:190/327 - (58%) Gaps:25/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 FDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKY--GITEFADMTS 362
            |:.|...:..|:::..::|.|..|.::|::|:.||...|.:.|.. ::|..|:  .:.::||:..
Mosquito    21 FELVKEEWTAFKLQHRKKYDSETEERIRMKIYVQNKHKIAKHNQRYDLGQEKFRLRVNKYADLLH 85

  Fly   363 SEY--------KERTGLWQ--RDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGS 417
            .|:        :..:|..|  |.|.|........:...:.::|...|||.|.||||||:||.|||
Mosquito    86 EEFVHTLNGFNRSVSGKGQLLRGELKPIEEPVTWIEPANVDVPTAMDWRTKGAVTQVKDQGHCGS 150

  Fly   418 CWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDNAYKAIKDIGGLEYEAEY 480
            ||:||.||.:||.:..|||:|...|||.|:||...  ::.||||:||.|::.|||..|::.|..|
Mosquito   151 CWSFSATGALEGQHFRKTGKLVSLSEQNLVDCSQKYGNNGCNGGMMDFAFQYIKDNKGIDTEKSY 215

  Fly   481 PYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINAN--AMQFYRGGVSHP 543
            ||:|..::||:|.........||||:|:|||.|:.:.|...||:|:.|:|:  :.|||..||.  
Mosquito   216 PYEAIDDECHYNPKAVGATDKGFVDIPQGNEKALMKALATVGPVSVAIDASHESFQFYSEGVY-- 278

  Fly   544 WKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG-DNTCGVSEM 607
            ::..|..:.||||||.||||.::...     .||:||||||..||:|||.::.|. ||.||::..
Mosquito   279 YEPQCDSEQLDHGVLAVGYGTTEDGE-----DYWLVKNSWGTTWGDQGYVKMARNRDNHCGIATT 338

  Fly   608 AT 609
            |:
Mosquito   339 AS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 14/59 (24%)
Peptidase_C1A 395..611 CDD:239068 103/220 (47%)
AgaP_AGAP011828XP_001689282.1 PTZ00203 6..343 CDD:185513 125/327 (38%)
Inhibitor_I29 28..87 CDD:214853 14/58 (24%)
Peptidase_C1 127..343 CDD:278538 103/221 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D71650at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.