DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and Ctla2a

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001102585.1 Gene:Ctla2a / 498690 RGDID:1565540 Length:113 Species:Rattus norvegicus


Alignment Length:66 Identity:19/66 - (28%)
Similarity:40/66 - (60%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 VDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSAKY--GITEFADMTSSEY 365
            :|..:.:::.:||:.|....||..| .::.::.||||..||: :.|...:  |:.:|:|:|:.|:
  Rat    12 LDTEWEEWKKKFGKTYSPDEERHRR-AVWEESKKTIEAHNADYKQGKTSFYMGLNQFSDLTTEEF 75

  Fly   366 K 366
            :
  Rat    76 R 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410 17/59 (29%)
Peptidase_C1A 395..611 CDD:239068
Ctla2aNP_001102585.1 Inhibitor_I29 16..74 CDD:214853 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.