DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and R09F10.1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_509408.1 Gene:R09F10.1 / 181087 WormBaseID:WBGene00019986 Length:383 Species:Caenorhabditis elegans


Alignment Length:331 Identity:112/331 - (33%)
Similarity:171/331 - (51%) Gaps:33/331 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 SHRFDKVDH--LFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADM 360
            :|:.:.:.|  :|..|.::|.|:|.|..|.:.|.:||.:|:...|......:| ....:.||.|.
 Worm    70 NHKMENLKHEQMFNDFILKFDRKYTSVEEFEYRYQIFLRNVIEFEAEEERNLG-LDLDVNEFTDW 133

  Fly   361 TSSEYKERTGLWQRDEAKATGGSAAVVPAYHGEL-------PKEFDWRQKDAVTQVKNQGSCGSC 418
            |..|.::..     .|.|.|..... .|.:.|..       |...|||::..:|.:||||.||||
 Worm   134 TDEELQKMV-----QENKYTKYDFD-TPKFEGSYLETGVIRPASIDWREQGKLTPIKNQGQCGSC 192

  Fly   419 WAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYK 483
            |||:...::|...|:|.|:|...||||::|||..::.|:||....|.|.:|: .|||.|.||||.
 Worm   193 WAFATVASVEAQNAIKKGKLVSLSEQEMVDCDGRNNGCSGGYRPYAMKFVKE-NGLESEKEYPYS 256

  Fly   484 A-KKNQCHFNRTLSHVQVAGFVD---LPKGNETAMQEWLLANGPISIGIN-ANAMQFYRGGVSHP 543
            | |.:||......:.|    |:|   :...||..:..|:...||::.|:| ..||..||.|:.:|
 Worm   257 ALKHDQCFLKENDTRV----FIDDFRMLSNNEEDIANWVGTKGPVTFGMNVVKAMYSYRSGIFNP 317

  Fly   544 WKALCSKKNLD-HGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEM 607
            ....|::|::. |.:.::|||...      ...|||||||||..||..||:|:.||.|:||::..
 Worm   318 SVEDCTEKSMGAHALTIIGYGGEG------ESAYWIVKNSWGTSWGASGYFRLARGVNSCGLANT 376

  Fly   608 ATSAVL 613
            ..:.::
 Worm   377 VVAPII 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/56 (30%)
Peptidase_C1A 395..611 CDD:239068 87/221 (39%)
R09F10.1NP_509408.1 Inhibitor_I29 82..138 CDD:285458 17/56 (30%)
Peptidase_C1 169..381 CDD:278538 87/222 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.