DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and Ctla2b

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_031823.1 Gene:Ctla2b / 13025 MGIID:88555 Length:113 Species:Mus musculus


Alignment Length:83 Identity:24/83 - (28%)
Similarity:36/83 - (43%) Gaps:24/83 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNAN-EMGSA 350
            ||.|.||                    .|.:.|....||..|| ::.:|.|.||..||: |.|..
Mouse    15 EWKEWKT--------------------TFAKAYSLDEERHRRL-MWEENKKKIEAHNADYERGKT 58

  Fly   351 KY--GITEFADMTSSEYK 366
            .:  |:.:|:|:|..|::
Mouse    59 SFYMGLNQFSDLTPEEFR 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410 18/59 (31%)
Peptidase_C1A 395..611 CDD:239068
Ctla2bNP_031823.1 2 X 3 AA tandem repeats of E-W-K 15..20 3/4 (75%)
Inhibitor_I29 16..74 CDD:214853 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.