DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and LOC1273089

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:XP_312035.5 Gene:LOC1273089 / 1273089 VectorBaseID:AGAMI1_005015 Length:98 Species:Anopheles gambiae


Alignment Length:126 Identity:28/126 - (22%)
Similarity:46/126 - (36%) Gaps:35/126 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TDPAVNSVAGDPAEKARLLNEKYVHRSRRSANDILGRHKPYDEEAAKAQLQKSLDKLTAGEGPHY 217
            ::|....|:.||.     || |..|..|..|                        .|...:|...
Mosquito     3 SEPKCGGVSDDPE-----LN-KEEHAERIGA------------------------ALATTDGHAG 37

  Fly   218 KIVKVYSASRQVDSGILTRIDADLIDGSEEQHRCIVDIWTKVWVR-KDEHE---ITFKCRN 274
            |..|::..::||.||: ..:.....:..|...:..:.:|.:.|:: ||..|   |||:..|
Mosquito    38 KAYKLHRVTKQVVSGV-QYVYFISFENEESGQQYKITVWERPWLKEKDPAEARKITFEVHN 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410
Peptidase_C1A 395..611 CDD:239068
LOC1273089XP_312035.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.