DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and CTSC

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:466 Identity:115/466 - (24%)
Similarity:176/466 - (37%) Gaps:134/466 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GPHYKIVKVYSASRQVDSGILTRIDADLIDGSEEQHRCIV-----DI------WTKVWVRKDE-H 266
            ||..|.|.||          |.::|....|.....|..|:     :|      |...:..|:| .
Human    58 GPQEKKVVVY----------LQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGS 112

  Fly   267 EITFKCRNQPVVQARHTRSVEWA--------------------EKKTHKKHSHRFDKVDHLFYKF 311
            ::|..|...............||                    .|.:.:|:|:|..|.||.|   
Human   113 KVTTYCNETMTGWVHDVLGRNWACFT
GKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNF--- 174

  Fly   312 QVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGLWQRDE 376
                                       ::.:||.:           ...|::.|.|...|...|.
Human   175 ---------------------------VKAINAIQ-----------KSWTATTYMEYETLTLGDM 201

  Fly   377 AKATGGSAAVVP--------------AYHGELPKEFDWRQK---DAVTQVKNQGSCGSCWAFSVT 424
            .:.:||.:..:|              ..|  ||..:|||..   :.|:.|:||.|||||::|:..
Human   202 IRRSGGHSRKIPRPKPAPLTAEIQQKILH--LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASM 264

  Fly   425 GNIEGLYAVKTGELKE--FSEQELLDCDTTDSACNGG---LMDNAYKAIKDIGGLEYEAEYPYKA 484
            |.:|....:.|...:.  .|.||::.|......|.||   |:  |.|..:|.|.:| ||.:||..
Human   265 GMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLI--AGKYAQDFGLVE-EACFPYTG 326

  Fly   485 KKNQCHFNR------TLSHVQVAGFVDLPKG-NETAMQEWLLANGPISIGINA-NAMQFYRGGVS 541
            ..:.|....      :..:..|.||..   | ||..|:..|:.:||:::.... :....|:.|:.
Human   327 TDSPCKMKEDCFRYYSSEYHYVGGFYG---GCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIY 388

  Fly   542 H------PWKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDN 600
            |      |:...   :..:|.||:||||......    :.|||||||||..|||.||:|:.||.:
Human   389 HHTGLRDPFNPF---ELTNHAVLLVGYGTDSASG----MDYWIVKNSWGTGWGENGYFRIRRGTD 446

  Fly   601 TCGVSEMATSA 611
            .|.:..:|.:|
Human   447 ECAIESIAVAA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856 16/69 (23%)
Inhibitor_I29 308..365 CDD:285458 4/56 (7%)
Peptidase_C1A 395..611 CDD:239068 75/237 (32%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344 19/89 (21%)
Peptidase_C1A_CathepsinC 231..460 CDD:239112 77/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.