DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Ctsq

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_083912.2 Gene:Ctsq / 104002 MGIID:2137385 Length:343 Species:Mus musculus


Alignment Length:347 Identity:117/347 - (33%)
Similarity:174/347 - (50%) Gaps:59/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 VEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELN-ANEMGS 349
            |||      |:....|:|:               .|..|..:|..|:.:|:|.|:..| .|.:|.
Mouse    27 VEW------KEWMGSFEKL---------------YSPEEEVLRRAIWEENVKRIKLHNRENSLGK 70

  Fly   350 AKY--GITEFADMTSSEY------------KERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDW 400
            ..|  |:..|||||..|:            ..|..||:|    |.|........:...|||..||
Mouse    71 NTYTMGLNGFADMTDEEFMNIVIGATLPVDNTRKSLWKR----ALGSPFPKSWYWKDALPKFVDW 131

  Fly   401 RQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT--DSACNGGLMDN 463
            |.:..||:|:||.:|.|||||.|||.|||....|||:|...|.|.|:||...  :..|..|...|
Mouse   132 RNEGYVTRVRNQRNCNSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLVDCSRPQGNRGCRWGNTYN 196

  Fly   464 AYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGI 528
            .::.:...||||.:|.|||:.|:..|.:|...|..::.|||.||: :|..:.:.:...|||:.||
Mouse   197 GFQYVLHNGGLEAQATYPYEGKEGLCRYNPKNSAAKITGFVVLPE-SEDVLMDAVATKGPIATGI 260

  Fly   529 N--ANAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGV----SDYPNFHKTLPYWIVKNSWGPRW 587
            :  :::.:||.|||.  ::..|: .:::|.||::|||.    :|..|      ||::|||||.||
Mouse   261 HVVSSSFRFYDGGVY--YEPNCT-SSVNHAVLIIGYGYVGNETDGNN------YWLIKNSWGRRW 316

  Fly   588 GEQGYYRVYRG-DNTCGVSEMA 608
            |..||..:.:. :|.|.::.:|
Mouse   317 GLSGYMMIAKDRNNHCAIASLA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 17/59 (29%)
Peptidase_C1A 395..611 CDD:239068 86/223 (39%)
CtsqNP_083912.2 Inhibitor_I29 29..87 CDD:214853 21/78 (27%)
Peptidase_C1 125..342 CDD:278538 87/224 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.