DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps37B and vps37c

Sequence 1:NP_001246926.1 Gene:Vps37B FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001071253.1 Gene:vps37c ZFINID:ZDB-GENE-061110-126 Length:323 Species:Danio rerio

Alignment Length:260 Identity:66/261 (25%)
Similarity:115/261 (44%) Gaps:66/261 (25%)


  Fly    16 MCHEELKELLNDDDKLDE---KVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAEL 77
            :...||::||::.::::.   :.||: |.::.::......|||.||:|::.:|:|...|.:|.| 
Zfish     7 LSQSELQDLLDNLERVESMALESDEI-QNIQLEREMALAANRSLAEQNLDMKPRIENDRARLVE- 69

  Fly    78 SEDGRTRCSSVQEKLSQ---LKEK-SGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVED 138
               ..|...:|:||..|   |::. .|.|..|..|:.||...:.:|.::|.:..:|.:..|.::.
Zfish    70 ---KYTELEAVREKYKQHCVLRDSIMGQVSPEGLLSRLQAEGASTEAESEALADEFLEGSISLDS 131

  Fly   139 FLDAFLPIRRTMHLRRLKAEKMQELMRK--------------------------QRQGPGPNTSL 177
            ||:.||.:|...|.||::.||:||::.:                          |:|.|..::.:
Zfish   132 FLERFLSLRSLAHTRRVRIEKLQEILSQKSKGIGDATIASQPCASQDAGSSSPWQQQQPQQSSKI 196

  Fly   178 PAYGNVPSSGF----YPASGGSA-------------PYPIMGPLMPMP-----------PPSRPY 214
            .|..|..||..    ||.:..||             |||..|...|..           ||:.||
Zfish   197 NAPSNASSSALPYSPYPVAPPSASTAGSTNPSTAFQPYPSQGAPFPQATGFPAPRPAFGPPACPY 261

  Fly   215  214
            Zfish   262  261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 7/29 (24%)
Mod_r 19..153 CDD:284587 40/141 (28%)
vps37cNP_001071253.1 Mod_r 5..146 CDD:284587 40/144 (28%)
CENP-H 9..93 CDD:283493 24/89 (27%)
MFMR 210..298 CDD:285072 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28607092
eggNOG 1 0.900 E1_KOG3270
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4994
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002072
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13678
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5541
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.