DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps37B and vps37b

Sequence 1:NP_001246926.1 Gene:Vps37B FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_989045.1 Gene:vps37b XenbaseID:XB-GENE-5714906 Length:287 Species:Xenopus tropicalis

Alignment Length:210 Identity:71/211 (34%)
Similarity:111/211 (53%) Gaps:25/211 (12%)


  Fly    20 ELKELLNDDDKLDEKVDEV--LQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGR 82
            ||.|||.|::||...|.|:  .|.::..|......|||.||.|:..:|.:..|:..|.:..::.:
 Frog    15 ELNELLEDEEKLGHIVQEMDEPQNVQLSKEMTLAGNRSLAEGNLLLQPDLETLKATLTQKYQELQ 79

  Fly    83 TRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIR 147
            :...|.|.|.::|.::|....|||.|||||...::.||:||.|.:.|.|..|.:::|.|.::..|
 Frog    80 SLIESHQLKKTKLDKQSVNSSLETLLALLQAEGAKIEEETENMAENFLDGGIQLDNFTDEYMNKR 144

  Fly   148 RTMHLRRLKAEKMQELMRKQRQGPGPNTSLPAYGNVPSSGFYPA---SGGSAPYPI-------MG 202
            :..||||:|.||:||::.|.::       ||....:|.:|  |:   ....||||.       :.
 Frog   145 KLAHLRRVKIEKLQEMVMKGQR-------LPQVSVLPQAG--PSETNQAPQAPYPTNFATPLPVT 200

  Fly   203 PLMPMPP----PSRP 213
            |..|:||    ||:|
 Frog   201 PRRPVPPPPQAPSQP 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 11/24 (46%)
Mod_r 19..153 CDD:284587 47/135 (35%)
vps37bNP_989045.1 Mod_r 25..153 CDD:311259 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28609054
eggNOG 1 0.900 E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11649
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1197293at2759
OrthoFinder 1 1.000 FOG0002072
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.842 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.