DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps37B and Vps37b

Sequence 1:NP_001246926.1 Gene:Vps37B FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_006249394.1 Gene:Vps37b RGDID:1304576 Length:307 Species:Rattus norvegicus

Alignment Length:186 Identity:60/187 (32%)
Similarity:95/187 (51%) Gaps:21/187 (11%)


  Fly    40 QVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGRTRCSSVQEKLSQLKEKSGGVGL 104
            |.::..|......|||.||.|:..:||:...:.:|.:..::.:....:.|.|.::|.::|....|
  Rat    61 QTVQHNKEMTLASNRSLAEGNLLYQPQLDAQKARLTQKYQELQVLFEAYQIKKTKLDKQSNSASL 125

  Fly   105 ETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIRRTMHLRRLKAEKMQELMRKQRQ 169
            ||.|||||...::.||.||.|.:||.|.::.::.|:|.:...|:..|:||:|.||:|||:.|.::
  Rat   126 ETLLALLQAEGAKIEEDTENMAEKFLDGELPLDAFIDVYQSKRKLAHIRRVKVEKLQELVLKGQR 190

  Fly   170 GPGPNTSLPAYGNVPSSGFYPASGGSAPYPIMGPL------------MPMPPPSRP 213
            .|.....||.  .||.    |:...:.|||   ||            :|.|||..|
  Rat   191 LPQAGVPLPP--RVPE----PSPATALPYP---PLEATGLPSVVPRRIPPPPPPVP 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 1/2 (50%)
Mod_r 19..153 CDD:284587 35/113 (31%)
Vps37bXP_006249394.1 Mod_r 59..174 CDD:284587 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28604526
eggNOG 1 0.900 E1_KOG3270
Hieranoid 1 1.000
Homologene 1 1.000 H11649
Inparanoid 1 1.050 103 1.000 Inparanoid score I4787
OMA 1 1.010
OrthoDB 1 1.010 D1197293at2759
OrthoFinder 1 1.000 FOG0002072
OrthoInspector 1 1.000 T618871
orthoMCL 1 0.900 OOG5_133494
Panther 1 1.100 O PTHR13678
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.