DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps37B and CD4.11

Sequence 1:NP_001246926.1 Gene:Vps37B FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001343627.1 Gene:CD4.11 WormBaseID:WBGene00044542 Length:496 Species:Caenorhabditis elegans

Alignment Length:126 Identity:31/127 (24%)
Similarity:50/127 (39%) Gaps:38/127 (30%)


  Fly    42 LRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELS-----EDGRTRCSSVQEKL--------- 92
            :|.:.|::..|:.:..: |:....||.||..:..|.|     ||  |..||....|         
 Worm   223 VRIEVTNIDPDSIALID-NLHYNGQICELVDEAIEQSVEPFPED--TNSSSTVPSLITGDPLPTD 284

  Fly    93 ---SQLKEKSGGVGLE-----TALAL--LQTAASESEEQTEEMVKK----------FNDSD 133
               .:..|:.|. |||     :|:.:  :.:.||...|.::..||:          |||.|
 Worm   285 PTIQKFFEEDGN-GLEDNDASSAITVQKITSTASSILESSQVNVKELSSCSALTCTFNDGD 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 31/127 (24%)
Mod_r 19..153 CDD:284587 31/127 (24%)
CD4.11NP_001343627.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133494
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.