DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps37B and VPS37A

Sequence 1:NP_001246926.1 Gene:Vps37B FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001350102.1 Gene:VPS37A HGNCID:24928 Length:397 Species:Homo sapiens

Alignment Length:154 Identity:38/155 (25%)
Similarity:72/155 (46%) Gaps:18/155 (12%)


  Fly    20 ELKELLNDDDKLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGRTR 84
            :||:::.|.|.|.:.::|:                  |.:|:..||.:...|..:.:..|.....
Human   261 QLKQIITDKDDLVKSIEEL------------------ARKNLLLEPSLEAKRQTVLDKYELLTQM 307

  Fly    85 CSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIRRT 149
            .|:.::|:.:..|.|.........|.|:.||.|:||:::.:.:.|.:..:.::|||.:|:..|..
Human   308 KSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTI 372

  Fly   150 MHLRRLKAEKMQELMRKQRQGPGP 173
            .|.||.|.||:|:.:....|...|
Human   373 CHCRRAKEEKLQQAIAMHSQFHAP 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 6/22 (27%)
Mod_r 19..153 CDD:284587 30/133 (23%)
VPS37ANP_001350102.1 Mod_r 235..379 CDD:311259 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.