DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps37B and Vps37c

Sequence 1:NP_001246926.1 Gene:Vps37B FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001348887.1 Gene:Vps37c MGIID:2147661 Length:352 Species:Mus musculus

Alignment Length:238 Identity:66/239 (28%)
Similarity:114/239 (48%) Gaps:47/239 (20%)


  Fly    19 EELKELLNDDD---KLDEKVDEVLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSED 80
            :||:|:.||.:   :|..:..|| |.|:.::......|||.||:|:|.:..:...|..|::..::
Mouse    10 QELEEMQNDPEAIARLALESPEV-QDLQLEREMALATNRSLAEQNLEFQGPLEISRSNLSDKYQE 73

  Fly    81 GRTRCSSVQEKLSQLKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLP 145
            .|......||:.::|::.|..:...|.|.|||....:.||::|.|.:||.:.::.:|.||::|..
Mouse    74 LRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAEKFLEGEVPLETFLESFSS 138

  Fly   146 IRRTMHLRRLKAEKMQELMRKQR------------------------------QGPGPNTSLP-- 178
            :|..:||||::.||:|:::|:.|                              |.|.|:...|  
Mouse   139 MRTLLHLRRVRVEKLQDVVRRPRALPELAGDVPPKRPPPPRPVPQATPPETEEQPPQPSVVTPYP 203

  Fly   179 -AYGNVPSSGFYPASGGS---APYPIM-------GPLMPMPPP 210
             .|...|.....|.:.|:   ||:|::       |||.|.|.|
Mouse   204 LPYSPSPGLPVGPTAQGALQPAPFPVVAQPSSYGGPLGPYPSP 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 9/26 (35%)
Mod_r 19..153 CDD:284587 42/137 (31%)
Vps37cNP_001348887.1 Mod_r 5..149 CDD:311259 44/140 (31%)
Atrophin-1 <184..313 CDD:331285 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28604454
eggNOG 1 0.900 E1_KOG3270
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4910
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1197293at2759
OrthoFinder 1 1.000 FOG0002072
OrthoInspector 1 1.000 T616750
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13678
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5541
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.